DataMorph Database Manager and Generator icon

DataMorph Database Manager and Generator

Go to Website
Hot or Not
DataMorph Database Manager and Generator

Description

DataMorph is a database management and scaffolding application. It allows users to quickly create database and generate tables with random data. This makes it easy in cases of scaffolding, prototyping and testing where you need to automatically fill your database with data. In addition, DataMorph provides basic function like search, download, table manipulation and more.

Demo:

Features

  • Database Scaffolder – The scaffolder is a simple tool to help you build a database without actually creating one. The process is painless thanks to modern technologies like ajax, pjax and sessions. While generating the created database, datamorph does not just work in silence, it updates you with live messages on what is going on in the background.
  • Auto Generator – This feature uses a read and write function that analyzes the field names in your table and uses the information to populate your table with random yet relevant data. just provide the number of rows you want generated and hit enter. hassle free.
  • Data Type Constraint – In addition to the usual field constraints like type, length, keys, we have created a data constraint; a dropdown with over 50 pieces of generatable data. data like credit card numbers, ip addresses, names, countries….. are all available for you to use.
  • Database Manager – The database management tool containts function to perform routine database manipulation tasks that include;
    • Downloading tables or databases.
    • Deleting databases.
    • Add or Removing tables.
    • Renaming tables.
    • Emptying tables.

Data Types

  • Int
  • Boolean
  • Word
  • Sentence
  • Paragraph
  • Text
  • Title
  • Name
  • First Name
  • Last Name
  • Phone number
  • Country
  • Latitude
  • Longitude
  • Postcode
  • Address
  • State
  • Street Address
  • State Abbreviation
  • City
  • City Suffix
  • Street Name
  • Secondary Address
  • City Prefix
  • Street Suffix
  • Building Number
  • Date
  • Time
  • Year
  • Century
  • Timezone
  • email
  • Company email
  • Username
  • Password
  • Domain Name
  • Domain Word
  • tld
  • url
  • slug
  • IPv4
  • local IPv4
  • ipv6
  • mac Address
  • userAgent
  • chrome
  • firefox
  • safari
  • opera
  • internetExplorer
  • Credit Card Type
  • Credit Card Number
  • credit Card Exp Date
  • Credit Card Details
  • SWIFTBIC Number
  • Hex Color
  • rgb Color
  • CSS rgb Color
  • Color Name
  • Image Url
  • Image
  • ean13
  • ean8
  • isbn13
  • isbn10
  • md5
  • sha1
  • sha256
  • locale
  • Country Code
  • language Code
  • Currency Code

Included

  • Bootstrap v4 – Bootstrap v4 is a brand new framework with new cool features, pronounced colors and more
  • PHP Faker Faker is a PHP library that generates fake data for you
  • Codeigniter CodeIgniter is a powerful PHP framework with a very small footprint

Categories

codecanyon

Tags

bootstrapcodeignterdatabasefakergeneratephpscriptssystemtables
BootstrapDatabase AbstractionsWebsite

External listing. code.market does not sell this product and does not process payment for it. Pricing, payment, delivery, licensing, refunds, and support are handled by the third-party merchant on its own website. We may earn an affiliate commission from a referral. Details.

Products of the Week.

Submit
UltimateSpeed PHP Code Generator Enterprise icon

UltimateSpeed PHP Code Generator Enterprise

Go to Website
Hot or Not
UltimateSpeed PHP Code Generator Enterprise

Description

Ultimate Speed is a powerful tool to increase web development productivity, saves a lot of time and increase your profit. Instant codes, CRUD and report generation with beautiful UI. Connect your existing database or create new one and generates Models, Controllers, Routs, Forms, DataGrid, Language file and Layout.

See the demo in action

Super Admin Username: admin@hezecom.com Password: hezecom22 Users Username: user@hezecom.com Password: hezecom22

See the video in action

Detail Features

  1. Responsive landing page
  2. Responsive admin and users interface
  3. Well structured project
  4. Graphical ready admin dashboard
  5. Light weight and fast
  6. Build in secured auth
  7. Bootstrap 5
  8. User Roles Management
  9. Chart layout dashboard
  10. Admin and Users Login
  11. Slim 4.x
  12. Twig 3.x
  13. Eloquent Database ORM
  14. Friendly GUI
  15. Roles Management
  16. Auto Detect Relational database
  17. Support table join, master detail
  18. Reporting/Export (Excel, CSV, PDF)
  19. Auto generate translated language file for all table fields
  20. CRUD Generated are purely best practices
  21. Instant code preview after generating
  22. Generated code support multi database connection
  23. Option to Enable or Disable HTML5 form validation
  24. Detect form input
  25. Detect Enum field and use as dropdown
  26. Detect (TEXT,MEDIUMTEXT,LONGTEXT) and use as textarea
  27. Generated codes are well commented
  28. Single or multiple File/Image Uploading
  29. Full Documentation

Requirement

  • PHP 7.4 or 8.x
  • MySQL 5+
  • OpenSSL PHP Extension
  • PDO PHP Extension
  • GD Extension
  • PHP ZIP Extension

CHANGELOG

        ===== 28/03/2023 - VERSION 5.8 =====
        - Fix bugs and some compatibility issue with PHP 8.2

        ===== 24/02/2023 - VERSION 5.7 =====
        - Library updated to support latest PHP version
        - Bug fixed
   
        =====  30/05/2022 - VERSION 5.5 =====
        - Bug fixed
   
        =====  10/04/2022 - VERSION 5.2 =====
        - Fixed auth issues
   
        =====  19/03/2022 - VERSION 5.1 =====
        - All new code generator design
        - Landing page
        - New project structure
        - New file tree structure       
   
        =====  01/03/2022 - VERSION 5.0 =====
        - All new design
        - Code rewritten from scratch
        - Completely new interface
        - New code structure
        - Bootrap 5
        - Twig for templating
        - Slim for routing
        - New secure auth
        - Support PHP 7.4 and 8.0+
   
=====  12/01/2018 - VERSION 3.2 =====
- Compatibility with PHP 7.x
- Now uses dompdf for reporting
- Better password security

===== 03/07/2015 - VERSION 3.0 =====
- New Improved design and code structure
- Ready to use dashboard with database statistics
- Auto generate charts summary based on record on each table
- Autocomplete search for each table
- Ability to choose between full Ajax forms and none Ajax forms
- Different validation option: HTML5, AJAX and PHP validation
- Now have HTML 5 lite Editor


===== 13/05/2014 - Version 2.0 =====
- Admin Panel with login. Users management system, create unlimited users with roles.
Export header_error fix.

- Better code structure to meet MVC standard

- Validation made easier with example on how to on controller page with error handling generated automatically.
E.g.
if (post('slug')==''){
$errors[] = 'A value is required!';
}

- Better pagination structure to accept more gets.
- You can now export only one record on detail page and all on viewall page
- Jquery library updated to v1.10.2
- Bootstrap library updated v3.1.1

===== 22/12/2013 - Version 1.5 =====
PHP pagination to handle big data.
jQuery pagination
Secured Directory

===== 07/11/2013 - Version 1.0  =====
First release

Pro Edition

Categories

codecanyon

Tags

adminbootstrapcodecode generatordatabasedevelopergeneratorjqueryloginmvcmysqlphpspeed
BootstrapCodeDatabase AbstractionsWebsite

External listing. code.market does not sell this product and does not process payment for it. Pricing, payment, delivery, licensing, refunds, and support are handled by the third-party merchant on its own website. We may earn an affiliate commission from a referral. Details.